SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000397473 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000397473
Domain Number - Region: 32-103
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000602
Family Cgl1923-like 0.021
Further Details:      
 
Domain Number - Region: 126-157
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), N-terminal domain 0.0959
Family delta-Endotoxin (insectocide), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397473   Gene: ENSG00000117362   Transcript: ENST00000414276
Sequence length 195
Comment pep:known chromosome:GRCh38:1:150265399:150269209:-1 gene:ENSG00000117362 transcript:ENST00000414276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGRCSALPTTSCLISGLSFGIISG
VFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWAL
GLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQED
SRVMVYSALRIPPED
Download sequence
Identical sequences A0A2I2YTM3 A0A2I3MAF9 A0A2J8VEK3 A0A2K5DYQ1 A0A2K5J2X0 A0A2K5M5N1 A0A2K5S9G4 A0A2K5U501 A0A2K5ZI67 A0A2K6CB02 A0A2K6LKM4 A0A2K6RSN4 A0A2K6TBN5 F7FDK4
ENSP00000397473 NP_001230701.1.87134 NP_001230701.1.92137 XP_009243125.1.23681 ENSP00000397473 ENSP00000463082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]