SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397502 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397502
Domain Number 1 Region: 29-74
Classification Level Classification E-value
Superfamily MIT domain-like 0.0000000000000183
Family MIT domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSP00000397502
Domain Number - Region: 163-198
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0262
Family Mitotic arrest deficient-like 1, Mad1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397502   Gene: ENSG00000148572   Transcript: ENST00000435510
Sequence length 277
Comment pep:known chromosome:GRCh38:10:63133247:63155031:1 gene:ENSG00000148572 transcript:ENST00000435510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPGATTPLPKAAAYPGVYGSNGRTPQPAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLL
IQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEI
QGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENE
RLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANT
GKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
Download sequence
Identical sequences NP_001269334.1.87134 NP_001269334.1.92137 ENSP00000397502 ENSP00000397502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]