SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398050 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398050
Domain Number 1 Region: 137-195
Classification Level Classification E-value
Superfamily PH domain-like 0.00000276
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 2 Region: 39-67
Classification Level Classification E-value
Superfamily WW domain 0.00000282
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398050   Gene: ENSG00000165322   Transcript: ENST00000454919
Sequence length 196
Comment pep:known chromosome:GRCh38:10:31820444:31854180:-1 gene:ENSG00000165322 transcript:ENST00000454919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRS
EWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPE
NESSPSSPKHQDTDQEKYGLLNVTKIAENGKKVRKNWLSSWAVLQGSSLLFTKTQGSSTS
WFGSNQSKPEFTVDLK
Download sequence
Identical sequences H0Y5D8
ENSP00000398050 ENSP00000398050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]