SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398117 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398117
Domain Number 1 Region: 126-196
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000308
Family Fibronectin type III 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSP00000398117
Domain Number - Region: 32-87
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0017
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398117   Gene: ENSG00000091181   Transcript: ENST00000445701
Sequence length 196
Comment pep:known chromosome:GRCh38:3:3097990:3126613:-1 gene:ENSG00000091181 transcript:ENST00000445701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIAC
Download sequence
Identical sequences C9J6C4
ENSP00000398117 ENSP00000398117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]