SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398141 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398141
Domain Number 1 Region: 142-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.45e-21
Family Arfaptin, Rac-binding fragment 0.012
Further Details:      
 
Domain Number 2 Region: 18-100
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-18
Family PDZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398141   Gene: ENSG00000100151   Transcript: ENST00000424694
Sequence length 229
Comment pep:known chromosome:GRCh38:22:38057228:38072608:1 gene:ENSG00000100151 transcript:ENST00000424694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIK
Download sequence
Identical sequences A0A2J8LNW8 A0A2J8UWF4 F6V107
ENSP00000398141 ENSP00000398141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]