SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000398689 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398689
Domain Number 1 Region: 127-183
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000209
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSP00000398689
Domain Number - Region: 1-22
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0785
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398689   Gene: ENSG00000130751   Transcript: ENST00000439365
Sequence length 234
Comment pep:putative chromosome:GRCh38:19:47035329:47045758:1 gene:ENSG00000130751 transcript:ENST00000439365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSSVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSLADTPEIEASLTKV
PPSSLVQERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHALGLVALGHTLPPAPLA
ELPLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHVD
SCRGLRVAAVCGHSGWEREEPRGAPCALGQPRAQPSRGWPNSFGCLPASSQRGL
Download sequence
Identical sequences ENSP00000398689 ENSP00000398689 NP_001308015.1.87134 NP_001308015.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]