SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000399473 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399473
Domain Number 1 Region: 4-207
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.42e-72
Family Aldose 1-epimerase (mutarotase) 0.00000000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399473   Gene: ENSG00000143891   Transcript: ENST00000434934
Sequence length 218
Comment pep:putative chromosome:GRCh38:2:38681295:38741237:1 gene:ENSG00000143891 transcript:ENST00000434934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN
LAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN
GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQNWPDAVNQFPFQHGIIWRQRNLEDNSRIL
Download sequence
Identical sequences H7C1B5
ENSP00000399473 ENSP00000399473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]