SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400545 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000400545
Domain Number - Region: 177-247
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0298
Family NADH oxidase/flavin reductase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400545   Gene: ENSG00000143753   Transcript: ENST00000415210
Sequence length 261
Comment pep:known chromosome:GRCh38:1:224175756:224192353:1 gene:ENSG00000143753 transcript:ENST00000415210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPQLAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCIN
HSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVD
VDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIY
YFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNE
HHDFPNIPGKSLPLVRKIAAE
Download sequence
Identical sequences E7EMA0
ENSP00000400545 ENSP00000400545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]