SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000400727 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400727
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily DNA clamp 0.0000824
Family DNA polymerase processivity factor 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400727   Gene: ENSG00000136273   Transcript: ENST00000458191
Sequence length 259
Comment pep:known chromosome:GRCh38:7:47964320:47979553:-1 gene:ENSG00000136273 transcript:ENST00000458191 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQMEGVSAENNEIYL
ELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRK
LWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVCV
TTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTKALCNIVNNKMV
HFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences A0A2J8L956 G3QEC0
XP_008973702.1.60992 XP_016867604.1.92137 XP_018887227.1.27298 ENSP00000400727 ENSP00000416588 ENSP00000400727 ENSP00000416588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]