SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000400883 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400883
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-85
Family Calponin-homology domain, CH-domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 4456-4615
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 4284-4399
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 267-383
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 4680-4832
Classification Level Classification E-value
Superfamily Spectrin repeat 2.19e-27
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 3797-3956
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-24
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 7 Region: 4038-4178
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 3254-3411
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 4128-4278
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-23
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 2485-2634
Classification Level Classification E-value
Superfamily Spectrin repeat 9.1e-22
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 11 Region: 4828-4943
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 12 Region: 2017-2175
Classification Level Classification E-value
Superfamily Spectrin repeat 8.8e-21
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 13 Region: 2818-2972
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 14 Region: 5190-5272
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.15e-20
Family GAS2 domain 0.0006
Further Details:      
 
Domain Number 15 Region: 4893-5020,5050-5081
Classification Level Classification E-value
Superfamily Spectrin repeat 5.92e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 16 Region: 3690-3836
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-18
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 17 Region: 3031-3191
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-16
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 18 Region: 1236-1364,1391-1419
Classification Level Classification E-value
Superfamily Spectrin repeat 3.04e-16
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 19 Region: 701-803
Classification Level Classification E-value
Superfamily Spectrin repeat 4.75e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 20 Region: 3407-3523
Classification Level Classification E-value
Superfamily Spectrin repeat 6.05e-16
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 21 Region: 5101-5181
Classification Level Classification E-value
Superfamily EF-hand 7.19e-16
Family Polcalcin 0.044
Further Details:      
 
Domain Number 22 Region: 2706-2828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000202
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 23 Region: 3472-3619
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000108
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 24 Region: 3953-4067
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000013
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 25 Region: 1790-1909
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000197
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 26 Region: 1925-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000827
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 27 Region: 2617-2719
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000907
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 28 Region: 2234-2354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000111
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 2393-2502
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000206
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 608-700
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000393
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 31 Region: 777-883,1004-1025
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000317
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000400883
Domain Number - Region: 1555-1667
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00144
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 1021-1171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00393
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400883   Gene: ENSG00000151914   Transcript: ENST00000421834
Sequence length 5497
Comment pep:known chromosome:GRCh38:6:56457989:56843665:-1 gene:ENSG00000151914 transcript:ENST00000421834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITD
GNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNEC
SSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYR
AAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSI
HKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQ
NVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFL
EDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAAS
SSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEA
VIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQ
PENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQ
KSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLA
KHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKIVAERQQEYK
EKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKN
TENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKV
AAVKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEV
NGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLS
PEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQEL
ENLEAGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVD
TSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEAT
ASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKND
IQKTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQV
PLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSAR
FSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYM
QESTSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEA
VTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTP
EIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKD
MTDISHGYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPT
DTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKW
QELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQ
QVQILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSD
RCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEI
QQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACA
SSHQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKT
IAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVET
LWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCE
IDKEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLD
IHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVE
TIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAET
LQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLL
DRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKV
FQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQ
LQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRK
STVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQF
HETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQ
SLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWL
NEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEV
LIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYE
TQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDN
ERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSA
QLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINS
ERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLREL
IAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQ
STQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLK
QRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCD
HMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELI
AACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIA
GGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHT
VQDPLMELKLIWDSLEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPV
GGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQR
WQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQL
NVHMEVCAAFEAKEETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNER
KTKLEEALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVN
SHREQIIELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRA
KQFHEAWSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNR
TGRSLKEKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQAL
IDWLYRVEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSR
DDSSWVKVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLR
FHGVLPDDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWIT
IIRARFEEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEI
EEVKALIAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPA
SSLYPSGSQTQIETKNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDI
WRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFD
RDGDGYIDYYEFVAALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYR
FFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFIL
ADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKILHPLTRN
YGKPWLTNSKMSTPCKAAECSDFPVPSAEGTPIQGSKLRLPGYLSGKGFHSGEDSGLITT
AAARVRTQFADSKKTPSRPGSRAGSKAGSRASSRRGSDASDFDISEIQSVCSDVETVPQT
HRPTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences E9PHM6
ENSP00000400883 NP_899236.1.87134 NP_899236.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]