SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000401004 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401004
Domain Number 1 Region: 77-238
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.84e-56
Family Matrix metalloproteases, catalytic domain 0.0000000553
Further Details:      
 
Domain Number 2 Region: 249-322
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.03e-24
Family Hemopexin-like domain 0.0000823
Further Details:      
 
Domain Number 3 Region: 8-71
Classification Level Classification E-value
Superfamily PGBD-like 2.2e-20
Family MMP N-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401004   Gene: ENSG00000118113   Transcript: ENST00000438475
Sequence length 344
Comment pep:putative chromosome:GRCh38:11:102713130:102724781:-1 gene:ENSG00000118113 transcript:ENST00000438475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLD
MMKKPRCGVPDSGGFMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVAS
PLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTN
TSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLS
SNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPS
LPTGIQAAYEDFDRDLIFLFKDMITKDNSWSQVIPKAYQVPFQE
Download sequence
Identical sequences H7C1M3
ENSP00000401004 ENSP00000401004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]