SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000401063 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401063
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-48
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401063   Gene: ENSG00000066248   Transcript: ENST00000416114
Sequence length 187
Comment pep:putative chromosome:GRCh38:2:232885323:232901462:-1 gene:ENSG00000066248 transcript:ENST00000416114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFELVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEH
RMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELD
PKCRGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALDAHKELEMVVKACNEG
VRKMSRT
Download sequence
Identical sequences A0A2J8NES8 A0A2J8TQ04 C9JTV7
ENSP00000401063 ENSP00000401063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]