SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000401505 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401505
Domain Number 1 Region: 20-72
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000000016
Family Transferrin 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401505   Gene: ENSG00000091513   Transcript: ENST00000414694
Sequence length 115
Comment pep:known chromosome:GRCh38:3:133746393:133754582:1 gene:ENSG00000091513 transcript:ENST00000414694 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAVSRCCLKESGRKPYFLCFQSLWNNSLLTGKRSGCCDTGCRFGV
Download sequence
Identical sequences A0A2J8QIV2 F8WEK9
ENSP00000401505 ENSP00000401505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]