SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401564 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401564
Domain Number 1 Region: 99-244
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-56
Family Ran-binding domain 0.000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401564   Gene: ENSG00000099901   Transcript: ENST00000430524
Sequence length 278
Comment pep:known chromosome:GRCh38:22:20115938:20127357:1 gene:ENSG00000099901 transcript:ENST00000430524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSALGRARRTLSGRPFQRAPCKTRRALSLSAALRNVTKAQGGCPKSLVLWGCRPKRPRK
RRTSLKLAWRGTFCSSSLKISEDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEE
DEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHY
ITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIE
EREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ
Download sequence
Identical sequences A0A1D5RHC9 A0A2I3M5Z7 A0A2I3SUC0 A0A2J8RBN9 A0A2K5M2D6 A0A2K5WR12 A0A2K5ZMS6 A0A2K6BKU9 F6WQW2 G1R119
ENSP00000401564 ENSNLEP00000006890 NP_001265568.1.87134 NP_001265568.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]