SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000401584 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401584
Domain Number 1 Region: 4-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 1.83e-118
Family 2-methylcitrate dehydratase PrpD 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401584   Gene: ENSG00000102794   Transcript: ENST00000449753
Sequence length 481
Comment pep:known chromosome:GRCh38:13:76952477:76958636:1 gene:ENSG00000102794 transcript:ENST00000449753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPLKSITESFATAIHGLKVGHLTDRVIQRSKRMILDTLGAGFLGTTTEVFHIASQYSKIY
SSNISSTVWGQPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALAEALP
RSPKFSGLDLLLAFNVGIEVQGRLLHFAKEANDMPKRFHPPSVVGTLGSAAAASKFLGLS
STKCREALAIAVSHAGAPMANAATQTKPLHIGNAAKHGIEAAFLAMLGLQGNKQVLDLEA
GFGAFYANYSPKVLPSIASYSWLLDQQDVAFKRFPAHLSTHWVADAAASVRKHLVAERAL
LPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVPSFHECQINRP
QVRELLSKVELEYPPDNLPSFNILYCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEE
KFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNL
S
Download sequence
Identical sequences H7C1Q4
ENSP00000401584 ENSP00000401584 ENSP00000401584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]