SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000401605 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401605
Domain Number 1 Region: 162-343
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-48
Family DBL homology domain (DH-domain) 0.000000287
Further Details:      
 
Domain Number 2 Region: 329-482
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-47
Family Pleckstrin-homology domain (PH domain) 0.00000212
Further Details:      
 
Domain Number 3 Region: 89-170
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-21
Family SH3-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401605   Gene: ENSG00000182957   Transcript: ENST00000434675
Sequence length 550
Comment pep:putative chromosome:GRCh38:13:24251694:24303121:1 gene:ENSG00000182957 transcript:ENST00000434675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDFAFFLQPASRPPMPAHQVPPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNVSSD
GGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQLAINELISDGNVVCAEALWDHVT
MDDQELGFKAGDVIQVLEASNKDWWWGRSEDKEAWFPASFVRGYIRQCRKHTGMFTVAQL
ATIFGNIEDIYKFQRKFLKDLEKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGAC
LELANLMKQGKYRHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHG
DYSNIKAAYEAMKNVACLINERKRKLESIDKIARWQVSIVGWEGLDILDRSSELIHSGEL
TKITKQGKSQQRTFFLFDHQLVSCKKDLLRRDMLYYKGRLDMDEMELVDLGDGRDKDCNL
SVKNAFKLVSRTTDEVYLFCAKKQEDKARWLQACADERRRVQEDKEMGMEISENQKKLAM
LNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWH
TFNRLTPFRK
Download sequence
Identical sequences J3KQJ8
ENSP00000401605 ENSP00000401605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]