SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401679 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401679
Domain Number 1 Region: 87-159
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000235
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401679   Gene: ENSG00000117620   Transcript: ENST00000422078
Sequence length 224
Comment pep:known chromosome:GRCh38:1:99993043:100015341:1 gene:ENSG00000117620 transcript:ENST00000422078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYK
DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLK
ILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVL
TACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVY
Download sequence
Identical sequences ENSP00000401679 ENSP00000401679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]