SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000401838 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401838
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.01e-40
Family D-ribulose-5-phosphate 3-epimerase 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401838   Gene: ENSG00000197713   Transcript: ENST00000429921
Sequence length 178
Comment pep:known chromosome:GRCh38:2:210002628:210021576:1 gene:ENSG00000197713 transcript:ENST00000429921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKSCSVTQAEVQWHSQ
GPLQVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSL
DIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences K7C4Z4
ENSP00000394455 ENSP00000401838 ENSP00000403808 ENSP00000394455 ENSP00000401838 ENSP00000403808 gi|24307923|ref|NP_008847.1| NP_001265211.1.87134 NP_001265211.1.92137 NP_001265212.1.87134 NP_001265212.1.92137 NP_008847.1.87134 NP_008847.1.92137 XP_009442461.1.37143 XP_009442462.1.37143 XP_009442463.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]