SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402525 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402525
Domain Number 1 Region: 63-235
Classification Level Classification E-value
Superfamily L domain-like 1.75e-30
Family Ngr ectodomain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402525   Gene: ENSG00000182492   Transcript: ENST00000431891
Sequence length 238
Comment pep:putative chromosome:GRCh38:X:153494993:153506626:1 gene:ENSG00000182492 transcript:ENST00000431891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYS
AMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRS
WEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVE
LRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT
Download sequence
Identical sequences A0A2J8IPM6 C9JKG1
ENSP00000402525 ENSP00000470463 ENSP00000402525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]