SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402532 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402532
Domain Number 1 Region: 10-160
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 4.64e-28
Family 4HBT-like 0.0021
Further Details:      
 
Domain Number 2 Region: 179-243
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 9.69e-17
Family 4HBT-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402532   Gene: ENSG00000097021   Transcript: ENST00000418124
Sequence length 246
Comment pep:known chromosome:GRCh38:1:6264273:6393361:-1 gene:ENSG00000097021 transcript:ENST00000418124 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSGPDVETPSAIQICRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVA
ALARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQVNVMSENILTGAKKLTNKATLWY
VPLSLKNVDKVLEVPPVVYSRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEPNT
VSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHD
KIRKAP
Download sequence
Identical sequences A0A2J8KY59 A0A2J8URW8
ENSP00000402532 ENSP00000402532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]