SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402612 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402612
Domain Number 1 Region: 28-178
Classification Level Classification E-value
Superfamily PRTase-like 3.75e-46
Family Phosphoribosylpyrophosphate synthetase-like 0.000000832
Further Details:      
 
Domain Number 2 Region: 179-268
Classification Level Classification E-value
Superfamily PRTase-like 0.00000023
Family Phosphoribosylpyrophosphate synthetase-like 0.0000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402612   Gene: ENSG00000141127   Transcript: ENST00000412418
Sequence length 268
Comment pep:known chromosome:GRCh38:17:18858130:18923984:1 gene:ENSG00000141127 transcript:ENST00000412418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETR
VQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMR
KRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDY
RNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPS
LEIPMLIPKEKPPITVVGDVGGRIAIIV
Download sequence
Identical sequences A0A2J8J6Y6 A0A2J8R0L3 E7EPA1
ENSP00000399625 ENSP00000402612 ENSP00000399625 ENSP00000402612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]