SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000403101 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403101
Domain Number 1 Region: 25-160
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-36
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403101   Gene: ENSG00000173848   Transcript: ENST00000449083
Sequence length 160
Comment pep:known chromosome:GRCh38:10:5446609:5454522:1 gene:ENSG00000173848 transcript:ENST00000449083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHDETGGLLPIKRTIRVLDVNNQSFREQEELTHIFGDLDSYIPLHEDLLTRIGEATKP
DGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSRKL
DLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDA
Download sequence
Identical sequences A0A2J8KTV8 A0A2J8S322 Q5SQI6
ENSP00000403101 ENSP00000403101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]