SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000403271 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403271
Domain Number 1 Region: 2-182
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-53
Family DBL homology domain (DH-domain) 0.000000225
Further Details:      
 
Domain Number 2 Region: 190-319
Classification Level Classification E-value
Superfamily PH domain-like 4.31e-36
Family Pleckstrin-homology domain (PH domain) 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403271   Gene: ENSG00000101977   Transcript: ENST00000437564
Sequence length 429
Comment pep:known chromosome:GRCh38:X:139581771:139605779:-1 gene:ENSG00000101977 transcript:ENST00000437564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFH
NDIFLSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQR
KLKHRLRLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSM
HQIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFC
KRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVKGDNRKFEIWYGEKEEVYIVQASNVDV
KMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQNDEKQQGAFISTEETELE
HTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEENRPLMR
PVSEMALLY
Download sequence
Identical sequences H0Y662
ENSP00000403271 ENSP00000403271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]