SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000403349 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403349
Domain Number 1 Region: 30-465
Classification Level Classification E-value
Superfamily ALDH-like 1.31e-162
Family ALDH-like 0.000000000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403349   Gene: ENSG00000111275   Transcript: ENST00000416293
Sequence length 470
Comment pep:novel chromosome:GRCh38:12:111766887:111809638:1 gene:ENSG00000111275 transcript:ENST00000416293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDF
FSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKE
AGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELG
GKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRV
VGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQ
DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGT
VWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences A0A2J8XKZ5
ENSP00000403349 NP_001191818.1.87134 NP_001191818.1.92137 gi|325910904|ref|NP_001191818.1| ENSP00000403349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]