SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000403908 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403908
Domain Number 1 Region: 22-142
Classification Level Classification E-value
Superfamily FKBP-like 8.05e-30
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403908   Gene: ENSG00000077800   Transcript: ENST00000429879
Sequence length 199
Comment pep:known chromosome:GRCh38:7:73328333:73341297:1 gene:ENSG00000077800 transcript:ENST00000429879 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVK
YSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGT
LGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFYDAKAPCWVCCG
Download sequence
Identical sequences F8WD36
ENSP00000403908 ENSP00000403908 ENSP00000461242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]