SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404046 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404046
Domain Number 1 Region: 25-77
Classification Level Classification E-value
Superfamily SNF-like 0.000000000000051
Family SNF-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404046   Gene: ENSG00000130821   Transcript: ENST00000429147
Sequence length 112
Comment pep:known chromosome:GRCh38:X:153691461:153692215:1 gene:ENSG00000130821 transcript:ENST00000429147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFRHEDCANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACW
VLVYFCVWKGVKSTGKVPLEACSGEGGSALGAGCLCQAHLWQREVTRQSLAL
Download sequence
Identical sequences H7C249
ENSP00000404046 ENSP00000404046 ENSP00000470522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]