SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404168 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404168
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.8e-16
Family N5-glutamine methyltransferase, HemK 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404168   Gene: ENSG00000114735   Transcript: ENST00000443894
Sequence length 124
Comment pep:novel chromosome:GRCh38:3:50577124:50580676:1 gene:ENSG00000114735 transcript:ENST00000443894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHENAQSYEDPAALDGGEEGMDII
THILALAPRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCGRPRFLHIR
RSGP
Download sequence
Identical sequences H7C258
ENSP00000404168 ENSP00000404168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]