SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404552 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404552
Domain Number 1 Region: 31-88
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000228
Family Protein kinases, catalytic subunit 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404552   Gene: ENSG00000115694   Transcript: ENST00000420551
Sequence length 89
Comment pep:putative chromosome:GRCh38:2:241501517:241508586:-1 gene:ENSG00000115694 transcript:ENST00000420551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRGEFQSPRGLALKKGCAAACFKHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEV
VAIKIIDLEEAEDEIEDIQQEITVLSQCD
Download sequence
Identical sequences C9JFA1
ENSP00000404552 ENSP00000404552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]