SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000404855 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404855
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily DNA clamp 0.0000399
Family DNA polymerase processivity factor 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404855   Gene: ENSG00000136273   Transcript: ENST00000432627
Sequence length 183
Comment pep:putative chromosome:GRCh38:7:47969245:47979504:-1 gene:ENSG00000136273 transcript:ENST00000432627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQMEGVSAENNEIYL
ELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRK
LWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVCV
TTH
Download sequence
Identical sequences A0A2J8L958 A0A2J8U2K8 C9JCK8
ENSP00000404855 ENSP00000404855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]