SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000404873 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404873
Domain Number 1 Region: 9-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 8.24e-26
Family NadC N-terminal domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 114-164
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0000000000471
Family NadC C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404873   Gene: ENSG00000277669   Transcript: ENST00000449759
Sequence length 165
Comment pep:known chromosome:GRCh38:16:29663279:29695144:1 gene:ENSG00000277669 transcript:ENST00000449759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFF
DAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAA
AVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLG
Download sequence
Identical sequences ENSP00000404873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]