SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000405175 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405175
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily DNA clamp 0.0000324
Family DNA polymerase processivity factor 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405175   Gene: ENSG00000136273   Transcript: ENST00000433977
Sequence length 160
Comment pep:known chromosome:GRCh38:7:47975613:47978895:-1 gene:ENSG00000136273 transcript:ENST00000433977 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQMEGVSAENNEIYL
ELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRK
LWKDLQEPVVPDPDDLIFSSAGQERYLDVHESQEEKNFMA
Download sequence
Identical sequences A0A2I2Y6Y0 A0A2I3RZW9 F8WAW9
ENSP00000405175 ENSP00000405175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]