SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000405335 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405335
Domain Number 1 Region: 356-430
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000183
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 48-213
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000981
Family DBL homology domain (DH-domain) 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSP00000405335
Domain Number - Region: 251-320
Classification Level Classification E-value
Superfamily PH domain-like 0.0424
Family Pleckstrin-homology domain (PH domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405335   Gene: ENSG00000178038   Transcript: ENST00000434140
Sequence length 535
Comment pep:known chromosome:GRCh38:3:46670282:46693704:-1 gene:ENSG00000178038 transcript:ENST00000434140 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MCNPEEAALLRLEEVFSATLAHVNSLVLQPLLPAAPDPSDPWGRECLRLLQQLHKSSQQL
WEVTEESLHSLQERLRYPDSTGLESLLLLRGADRVLQAHIEYIESYTSCMVVQAFQKAAK
RRSEYWRGQRKALRQLLSGVSSEGSVGASLGQALHQPLAHHVQQYVLLLLSLGDTIGEHH
PTRELVVNAVTLFGNLQSFMKQELDQAVATQALWHTLRGRLRDVLCTPAHRLLQDSQDVP
VTVAPLRAERVLLFDDALVLLQGHNVHTFDLKLVWVDPGQDGCTFHLLTPEEEFSFCAKD
SQGQAVWQWKVTWAVHQALHGKKDFPVLGAGLEPSQPPDCRCAEYTFQAEGRLCQATYEG
EWCRGRPHGKGTLKWPDGRNHVGNFCQGLEHGFGIRLLPQASEDKFDCYKCHWREGSMCG
YGICTAPTRCTRATSRRACGTDLGSLRVVRRPPSPSGTRATGRGARGAAMALRRMVTEVS
ATLACGRLVSATAQGSWSPRQVSATRAPSRRTRRWARASSSLKTTPCMRAPSPGT
Download sequence
Identical sequences G5E9N5
ENSP00000405335 ENSP00000405335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]