SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000406642 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406642
Domain Number 1 Region: 10-158
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.14e-47
Family Nucleoside diphosphate kinase, NDK 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406642   Gene: ENSG00000172113   Transcript: ENST00000442597
Sequence length 186
Comment pep:novel chromosome:GRCh38:3:48294519:48301423:-1 gene:ENSG00000172113 transcript:ENST00000442597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFY
REHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFG
LTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGT
GGLGPA
Download sequence
Identical sequences A0A2I2YRA6 A0A2I3HWM5 H2QMI8 K7ET49 O75414
ENSNLEP00000007807 ENSP00000392352 ENSP00000399582 ENSP00000406642 ENSP00000440286 ENSP00000392352 ENSP00000399582 ENSP00000406642 ENSP00000440286 ENSPPYP00000023717 NP_001295355.1.87134 NP_001295355.1.92137 NP_001295356.1.87134 NP_001295356.1.92137 NP_001295357.1.87134 NP_001295357.1.92137 XP_002813841.1.23681 XP_003818472.1.60992 XP_004087955.1.23891 XP_008969979.1.60992 XP_008969984.1.60992 XP_008969985.1.60992 XP_008969986.1.60992 XP_009237329.1.23681 XP_009237330.1.23681 XP_009237331.1.23681 XP_009237333.1.23681 XP_009237334.1.23681 XP_009237335.1.23681 XP_012354710.1.23891 XP_012354711.1.23891 XP_016796508.1.37143 XP_016796509.1.37143 XP_016796510.1.37143 XP_016796511.1.37143 XP_016796515.1.37143 XP_016861003.1.92137 XP_018879660.1.27298 XP_018879661.1.27298 XP_018879662.1.27298 XP_018879667.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]