SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000406667 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406667
Domain Number 1 Region: 280-460
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-68
Family SPRY domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSP00000406667
Domain Number - Region: 206-251
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0455
Family YkuI C-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406667   Gene: ENSG00000026950   Transcript: ENST00000414912
Sequence length 461
Comment pep:known chromosome:GRCh38:6:26402295:26414073:1 gene:ENSG00000026950 transcript:ENST00000414912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKT
ASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELRE
MAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPI
LLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVC
SKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDIS
FYNAVDGSHIHTFLDVSFSEALYPVFRILTLEPTALTICPA
Download sequence
Identical sequences gi|222418658|ref|NP_001138480.1| ENSP00000406667 NP_001138480.1.87134 NP_001138480.1.92137 ENSP00000406667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]