SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407036 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000407036
Domain Number - Region: 19-83
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000902
Family Quinoprotein alcohol dehydrogenase-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407036   Gene: ENSG00000138073   Transcript: ENST00000430533
Sequence length 106
Comment pep:putative chromosome:GRCh38:2:27131159:27132620:-1 gene:ENSG00000138073 transcript:ENST00000430533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGHEVVS
CLDVSESGTFLGLGTVTGSVAIYIAFSLQGVFLCGSCSCCVSGLLL
Download sequence
Identical sequences H7C2N7
ENSP00000407036 ENSP00000407036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]