SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407055 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000407055
Domain Number - Region: 68-117
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.00523
Family Glutamine synthetase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407055   Gene: ENSG00000050030   Transcript: ENST00000424929
Sequence length 118
Comment pep:known chromosome:GRCh38:X:74737118:74740360:-1 gene:ENSG00000050030 transcript:ENST00000424929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKSNGKTAIGDPGRANMPGYNEDSRSTFFDKKYSNMSTLGNNGPTHKKLYRHKSSSKALR
DEKCKGKHMEREQVHKDESGTASFEKLRDSDYNLLKAETTFWVLPVFEEETRIFQKDI
Download sequence
Identical sequences H7C2N8
ENSP00000407055 ENSP00000407055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]