SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407140 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407140
Domain Number 1 Region: 29-146
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-35
Family Phosphate binding protein-like 0.000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407140   Gene: ENSG00000164418   Transcript: ENST00000436862
Sequence length 182
Comment pep:putative chromosome:GRCh38:6:101818370:101890384:1 gene:ENSG00000164418 transcript:ENST00000436862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEG
YCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITY
VREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVI
AR
Download sequence
Identical sequences H7C2P5
ENSP00000407140 ENSP00000407140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]