SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407544 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407544
Domain Number 1 Region: 56-173
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-26
Family DBL homology domain (DH-domain) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407544   Gene: ENSG00000066248   Transcript: ENST00000420650
Sequence length 174
Comment pep:novel chromosome:GRCh38:2:232892898:232905849:-1 gene:ENSG00000066248 transcript:ENST00000420650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLPRRGGSRAEGLLTSQTGRLPGGGSPHIPDRAVGQRRSPHLRRWAAGRRCSSLPRWDGG
REEALLTSQAMFELVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAV
SERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLL
Download sequence
Identical sequences ENSP00000407544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]