SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407776 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407776
Domain Number 1 Region: 63-139
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.92e-25
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 2 Region: 2-54
Classification Level Classification E-value
Superfamily EF-hand 0.000000000542
Family Polcalcin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407776   Gene: ENSG00000127603   Transcript: ENST00000442046
Sequence length 368
Comment pep:novel chromosome:GRCh38:1:39460747:39486987:1 gene:ENSG00000127603 transcript:ENST00000442046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTT
DADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMA
LDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSS
ASQSNHSCTSMPSSPATPASGTKTSLQFSRCYDKPWLVNSKAGTPIRDSHSPDLQLPTPE
VIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRA
GSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTAS
PRTPGPKR
Download sequence
Identical sequences H0Y6T5
ENSP00000407776 ENSP00000407776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]