SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407861 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407861
Domain Number 1 Region: 172-435
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.42e-87
Family Eukaryotic proteases 0.00000000047
Further Details:      
 
Domain Number 2 Region: 69-175
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-31
Family Kringle modules 0.00000602
Further Details:      
 
Domain Number 3 Region: 36-84
Classification Level Classification E-value
Superfamily FnI-like domain 1.73e-20
Family Fibronectin type I module 0.0000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407861   Gene: ENSG00000104368   Transcript: ENST00000429710
Sequence length 436
Comment pep:novel chromosome:GRCh38:8:42175747:42207565:-1 gene:ENSG00000104368 transcript:ENST00000429710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKRNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIG
KVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQ
PQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPH
HLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVV
RTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTV
TDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVY
TKVTNYLDWIRDNMRP
Download sequence
Identical sequences A0A2I3SJC7 B4DNJ1
ENSP00000407861 ENSP00000407861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]