SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407952 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407952
Domain Number 1 Region: 168-465
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.28e-41
Family NadC C-terminal domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  ENSP00000407952
Domain Number - Region: 68-99
Classification Level Classification E-value
Superfamily DUSP-like 0.0209
Family DUSP, domain in ubiquitin-specific proteases 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407952   Gene: ENSG00000229644   Transcript: ENST00000440465
Sequence length 472
Comment pep:known chromosome:GRCh38:10:36521721:36524234:-1 gene:ENSG00000229644 transcript:ENST00000440465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEK
IQEAKDVYKEHFQDDVVNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDP
ECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVS
SQETAGIGASAHLVNFKGTDTVAGLALNKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEK
DAFEHIVTQFSSVPVSVVSNSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLD
TVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIA
FGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGN
FVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHH
Download sequence
Identical sequences ENSP00000407952 ENSP00000407952 ENSP00000407952 9606.ENSP00000407952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]