SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408070 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408070
Domain Number 1 Region: 93-247
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.03e-49
Family Matrix metalloproteases, catalytic domain 0.000000247
Further Details:      
 
Domain Number 2 Region: 271-344
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.79e-23
Family Hemopexin-like domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408070   Gene: ENSG00000099953   Transcript: ENST00000437086
Sequence length 354
Comment pep:known chromosome:GRCh38:22:23772849:23784316:1 gene:ENSG00000099953 transcript:ENST00000437086 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPA
PAPATQEAPRPASSLRPPRCGVPDPSDGLSARNRQKRILRFPWQLVQEQVRQTMAEALKV
WSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYD
ETWTIGDDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHL
YGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDAVSTIRGELFFFKAGFV
WRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGTTGVSTPAPGV
Download sequence
Identical sequences E9PED7
ENSP00000408070 ENSP00000408070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]