SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408232 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408232
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily FKBP-like 1.61e-30
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408232   Gene: ENSG00000141756   Transcript: ENST00000429461
Sequence length 81
Comment pep:putative chromosome:GRCh38:17:41812790:41818120:1 gene:ENSG00000141756 transcript:ENST00000429461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLY
Download sequence
Identical sequences A0A2J8KG70 A0A2J8RFE0 C9JPC3
ENSP00000408232 ENSP00000408232 ENSP00000454310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]