SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408270 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408270
Domain Number 1 Region: 205-284
Classification Level Classification E-value
Superfamily Kringle-like 3.59e-34
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 2 Region: 115-206
Classification Level Classification E-value
Superfamily Kringle-like 2.09e-33
Family Kringle modules 0.0000117
Further Details:      
 
Domain Number 3 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.1e-24
Family Hairpin loop containing domain 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408270   Gene: ENSG00000019991   Transcript: ENST00000453411
Sequence length 285
Comment pep:known chromosome:GRCh38:7:81742732:81770014:-1 gene:ENSG00000019991 transcript:ENST00000453411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEG
GPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKF
LPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCET
Download sequence
Identical sequences A0A2J8LGB0
NP_001010933.1.87134 NP_001010933.1.92137 XP_008974575.1.60992 XP_009451726.1.37143 XP_016867587.1.92137 ENSP00000408270 gi|58533165|ref|NP_001010933.1| ENSP00000408270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]