SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408319 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408319
Domain Number 1 Region: 2-48
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000353
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408319   Gene: ENSG00000205726   Transcript: ENST00000420666
Sequence length 66
Comment pep:known chromosome:GRCh38:21:33875358:33886377:1 gene:ENSG00000205726 transcript:ENST00000420666 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEDCLGA
ENQSCF
Download sequence
Identical sequences H0Y6W3
ENSP00000408319 ENSP00000408319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]