SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408595 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408595
Domain Number 1 Region: 170-393
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-54
Family C-terminal domain of adrenodoxin reductase-like 0.00000000619
Further Details:      
 
Domain Number 2 Region: 68-229
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.65e-20
Family N-terminal domain of adrenodoxin reductase-like 0.00000562
Further Details:      
 
Domain Number 3 Region: 366-521
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000636
Family N-terminal domain of adrenodoxin reductase-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408595   Gene: ENSG00000161513   Transcript: ENST00000413947
Sequence length 522
Comment pep:novel chromosome:GRCh38:17:74862609:74872976:-1 gene:ENSG00000161513 transcript:ENST00000413947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPTFGGSDEVRDPANAKALRNKRRRMQVRVKLGKFQ
LLLDIQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEKQPVPFGLVRFGVAPDHPEV
KNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELP
GVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITK
AALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEV
PRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLA
VTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMD
VPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRG
VRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLGH
Download sequence
Identical sequences A0A0A0MSZ4
ENSP00000408595 NP_001244942.2.87134 NP_001244942.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]