SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000408605 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408605
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily POZ domain 5.23e-28
Family BTB/POZ domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408605   Gene: ENSG00000156273   Transcript: ENST00000447177
Sequence length 220
Comment pep:known chromosome:GRCh38:21:29300802:29326484:1 gene:ENSG00000156273 transcript:ENST00000447177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFH
SRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEE
SCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQ
TPQCKLRRYQGNAKASPPLQDSASQTYESMCLEKDAALAL
Download sequence
Identical sequences C9JMP6
ENSP00000408605 ENSP00000408605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]