SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409125 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000409125
Domain Number - Region: 91-177
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00235
Family GABA-aminotransferase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409125   Gene: ENSG00000172296   Transcript: ENST00000450297
Sequence length 215
Comment pep:known chromosome:GRCh38:20:13009349:13079867:1 gene:ENSG00000172296 transcript:ENST00000450297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NCTKNGIVKEAQQNGKPHFYDKLIVESFEEAPLHVMVFTYMGYGIGTLFGYLRDFLRNWG
IEKCNAAVERKEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSAPGPLFDLMERVSDD
YNWTFRFTGRVIKDVINMGSYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGEFTS
SWQNALCVGGVLQADSVPQGPPWSWKMGRHSSLLE
Download sequence
Identical sequences B1AKS3
ENSP00000409125 ENSP00000409125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]