SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000409656 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409656
Domain Number 1 Region: 2-541
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 8.11e-82
Family Acetyl-CoA synthetase-like 0.0000144
Further Details:      
 
Domain Number 2 Region: 754-830
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000691
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 
Domain Number 3 Region: 553-608
Classification Level Classification E-value
Superfamily ACP-like 0.0000432
Family Acyl-carrier protein (ACP) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409656   Gene: ENSG00000157426   Transcript: ENST00000451613
Sequence length 857
Comment pep:known chromosome:GRCh38:4:56338287:56387508:-1 gene:ENSG00000157426 transcript:ENST00000451613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKSISSEHVNEEKA
EEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLFDITQEDVLFLASPL
TFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQL
IKSTVLSATTSLRVLALGGEAFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPE
KTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPL
GTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQE
KLILFMVSKDASVKEYIFKELQKYLPSHAVPDELVLIDSLPFTSHGKIDVSELNKIYLNY
INLKSENKLSGKEDLWEKLQYLWKSTLNLPEDLLRVPDESLFLNSGGDSLKSIRLLSEIE
KLVGTSVPGLLEIILSSSILEIYNHILQTVVPDEDVTFRKSCATKRKLSDINQEEASGTS
LHQKAIMTFTCHNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLK
GLNSPVLIGKSKDPSCVAKVSEEGKPAIGTQKMELHVRWRSDTGKCVDASPLVVIPTFDK
SSTTVYIGSHSHRMKAVDFYSGKVKWEQILGDRIESSACVSKCGNFIVVGLAVLYQWTNL
FIPVYLTIRAKNIFWFP
Download sequence
Identical sequences NP_001273600.1.87134 NP_001273600.1.92137 ENSP00000409656 ENSP00000409656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]