SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000409800 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409800
Domain Number 1 Region: 49-116
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-16
Family Pleckstrin-homology domain (PH domain) 0.0000516
Further Details:      
 
Domain Number 2 Region: 2-47
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000458
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 130-172
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000998
Family PLC-like (P variant) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409800   Gene: ENSG00000205726   Transcript: ENST00000415023
Sequence length 173
Comment pep:novel chromosome:GRCh38:21:33875360:33886354:1 gene:ENSG00000205726 transcript:ENST00000415023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEPIFLNE
VLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKA
YLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQD
Download sequence
Identical sequences A0A287CTR3 A0A2J8M7H7 A0A2J8UL68 F6S583 F6TCC6 Q6J334
ENSMMUP00000020339 ENSP00000409800 ENSMUSP00000115563 ENSP00000409800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]